Vn6.22 precursor (P00766) Protein Card

General Information
Name Vn6.22 precursor
Alternative name(s) VnMSGL-0123
Organism Conus ventricosus
Organism region Eastern Atlantic and Mediterranean
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O3 superfamily
Pharmacological family

Sequence
MSGLGIMVLTLLLLVSMATS
HQDGGGKQATQRDAINVRRRR
SITRR
EVVTEECEEYCKEQNKTCCGLTNGRPRCVGVCF
G
Sequence region
[1-20]signal sequence
[47-79]mature peptideVn6.22

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Nucleic acids Conus ventricosus clone VnMSGL-0123 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q9BP59
Ncbi AAG60507, Q9BP59

Tools