Ca14.5 precursor (P07695) Protein Card

General Information
Name Ca14.5 precursor (named by ConoServer)
Alternative name(s) Ca-33 precursor
Organism Conus caracteristicus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Cysteine framework XIV
Pharmacological family

Sequence
AQLPRDRTAR
VPAEPILELICPHMCRLGIGEPPFCKCRNKR
DVVSSRITS
RKRSMAM
Sequence evidence nucleic acid level
Sequence region
[1-10]signal sequence
[11-50]mature peptideCa14.5

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Nucleic acids
Structure

External links

Tools