Conkunitzin-Ge6 (P07803) Protein Card

General Information
Name Conkunitzin-Ge6 (named by ConoServer)
Alternative name(s) Ge-53
Organism Conus generalis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type

Classification
Conopeptide class conkunitzin
Gene superfamily
Pharmacological family

Sequence
CQLEPDTGLCRAAFRRFYYNWNEQQCQAFIYGGCGGNENRF
KSREECEQAC
Sequence evidence nucleic acid level
Average Mass 5985.56
Monoisotopic Mass 5981.55
Isoelectric Point 6.73
Extinction Coefficient [280nm] 9970.00

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Nucleic acids
Structure

External links

Tools