Qc12.1 precursor (P07817) Protein Card

General Information
Name Qc12.1 precursor (named by ConoServer)
Alternative name(s) Qu-9 precursor
Organism Conus quercinus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily I2 superfamily
Cysteine framework XII
Pharmacological family

Sequence
MVGRTSVSFLLFSIMVLGMVATVIC
SCEERISSEKCEAPGE
RICSCSNHVCCQLSAAKKDQCMTPFMCRTASGGN
RRRRSTQ
VQDRFLRMARGLAD
Sequence evidence nucleic acid level
Sequence region
[1-25]signal sequence
[26-75]mature peptideQc12.1

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Nucleic acids
Structure

External links

Tools