Qc9.1 precursor (P07842) Protein Card

General Information
Name Qc9.1 precursor (named by ConoServer)
Alternative name(s) Qc-VB-37,Qu-40 precursor
Organism Conus quercinus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily Divergent M---L-LTVA
Cysteine framework IX
Pharmacological family

Sequence
MEFRRLVTVTLLLTLVMSIDSVPA
DETETGRVSLREDDR
FP
CNSNQCACLPAEGSSTSYQCQSLDASTDDCFDNECVTQSEW
GGRR
Sequence evidence nucleic acid level
Sequence region
[1-24]signal sequence
[25-39]pro region
[40-82]mature peptideQc9.1

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193
Gao,B., Peng,C., Zhu,Y., Sun,Y., Zhao,T., Huang,Y. and Shi,Q. (2018) High Throughput Identification of Novel Conotoxins from the Vermivorous Oak Cone Snail (Conus quercinus) by Transcriptome Sequencing Int J Mol Sci 19:3901

Internal links
Nucleic acids
Structure

External links

Tools