Qc9.2 precursor (P07843) Protein Card

General Information
Name Qc9.2 precursor (named by ConoServer)
Alternative name(s) Qu-41 precursor
Organism Conus quercinus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily Divergent M---L-LTVA
Cysteine framework IX
Pharmacological family

Sequence
LATVALLLTLVMGIDSAPA
GQTEAGRVSLR
EGLENTFPCNP
GRCACLPASGTTTSYVCQSTQSSTADCMDNECVTEAEW
Sequence evidence nucleic acid level
Sequence region
[1-19]signal sequence
[20-30]pro region
[31-79]mature peptideQc9.2

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Nucleic acids
Structure

External links

Tools