Ar6.28 precursor (P00785) Protein Card

General Information
Name Ar6.28 precursor
Alternative name(s) ArMSGL-013
Organism Conus arenatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
RRSLTRR
VPEECEESCEEEEKTCCGLENGQPFCSRICW
G
Sequence region
[8-38]mature peptideAr6.28

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Nucleic acids Conus arenatus clone ArMSGL-013 conotoxin scaffold VI/VII precursor, mRNA, partial cds
Structure

External links
UniProtKB/Swiss-Prot Q9BP50
Ncbi Q9BP50, AAG60528

Tools