Conodipine-P4 precursor (P07904) Protein Card

General Information
Name Conodipine-P4 precursor (named by ConoServer)
Alternative name(s) Cdpi-P4 precursor
Organism Conus purpurascens
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conodipine
Gene superfamily conodipine superfamily
Pharmacological family

Sequence
MKLLAPVLWAMAALGVTWLVAVDS
KESCTKHSNGCSTPLRL
PCQEYFRPACDIHDNCYHCGTIFRISRKECDDAFLKDMNTL
CKKLGSNFATCPARG
KREVTSHRATSIAHSRLWKTALDQKS
FLNRKAR
QPILLTPNSCLYWANNFYMAVHVFGARSYSRTTD
PKDCQGLKHCLPNH
Sequence evidence nucleic acid level
Sequence region
[1-24]signal sequence
[25-97]mature peptideConodipine-P4 alpha chain
[131-178]mature peptideConodipine-P4 beta chain

References
Möller, C., Davis, W.C., Clark, E., DeCaprio, A. and Mari, F. (2019) Conodipine-P1-3, the First Phospholipases A2 Characterized from Injected Cone Snail Venom Molecular & Cellular Proteomics 18:876-891

Internal links
Nucleic acids Conodipine-P4 precursor
Structure

External links
Ncbi MK493030

Tools