T4.1 precursor (P07985) Protein Card

General Information
Name T4.1 precursor (named by ConoServer)
Alternative name(s) Tu050 precursor
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Cysteine framework I
Pharmacological family

Sequence
MGMRMMFTVFLFVVLATTGVS
FTLDRASDGWNAAAKESDVI
ALTRR
KCCSIPKCYKNNKKCVADDAGAHSCHQNNQDMC
G
Sequence evidence nucleic acid level
Sequence region
[1-21]signal sequence
[22-46]pro region
[47-79]mature peptideT4.1

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Nucleic acids
Structure

External links

Tools