Conopressin-T precursor (P07988) Protein Card

General Information
Name Conopressin-T precursor (named by ConoServer)
Alternative name(s) Tu058 precursor
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conopressin
Gene superfamily
Pharmacological family

Sequence
MGRLTLVLCLLLLLLLTTQ
A
CYIQNCLRV
GKRHVETTHPCM
SCSFGQCVGPRICCGPGGCEMGTAEANKCIAEDKNSTPCQV
LGDHCDLNNLDNIEGHCVADGICCVEDTCAIHSSC
Sequence evidence nucleic acid level
Sequence region
[1-19]signal sequence
[21-29]mature peptideConopressin-T

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Nucleic acids
Structure

External links

Tools