Con-ikot-ikot-T8 precursor (P07998) Protein Card

General Information
Name Con-ikot-ikot-T8 precursor (named by ConoServer)
Alternative name(s) Tu068 precursor
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class con-ikot-ikot
Gene superfamily
Pharmacological family

Sequence
MAMNMSMTLSVFVMVVVAATITG
FTHLQEPDPSRMKRYDR
G
CCINRTYQCLKRYRNRENKFASFCQQEAAVNCGTFTSGKGC
CYGYMHCMMINAETQTRETAHQYCQNRSCDPEE
Sequence evidence nucleic acid level
Sequence region
[1-23]signal sequence
[24-40]pro region
[41-115]mature peptideCon-ikot-ikot-T8

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Nucleic acids
Structure

External links

Tools