T8.1 precursor (P08006) Protein Card

General Information
Name T8.1 precursor (named by ConoServer)
Alternative name(s) Tu077 precursor
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily S superfamily
Cysteine framework VIII
Pharmacological family

Sequence
MMSKMGAMFVLLLLFTLASS
QQEGDVQARKTRLKSDFYRAL
PR
FGPICTCFKSQNCRGSCECMSPPGCYCSNNGIRERGCSC
TCPGT
G
Sequence evidence nucleic acid level
Sequence region
[1-20]signal sequence
[21-43]pro region
[44-87]mature peptideT8.1

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Nucleic acids
Structure

External links

Tools