Tu032 precursor (P08057) Protein Card

General Information
Name Tu032 precursor
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class unclassified
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MNLTCVLIIAVLFLTACQLLTA
DDSRNNQKYRAVRMRDALK
NLKDSR
GCSARNQRCPPNAAWVWCAVVSIHPDVFDI
R
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence
[48-77]mature peptideTu032

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Nucleic acids
Structure

External links

Tools