T6.3 (P08060) Protein Card

General Information
Name T6.3 (named by ConoServer)
Alternative name(s) Tu037
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor T6.3 precursor (7972)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
QVSWWCGKPEATCGKLYLKCCSGRCNKANWKCLR
Sequence evidence nucleic acid level
Average Mass 3915.61
Monoisotopic Mass 3912.81
Isoelectric Point 12.04
Extinction Coefficient [280nm] 17990.00

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Protein Precursor T6.3 precursor (7972)
Nucleic acids
Structure

External links

Tools