Tu032 (P08064) Protein Card

General Information
Name Tu032
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Tu032 precursor (8057)

Classification
Conopeptide class unclassified
Gene superfamily O1 superfamily
Pharmacological family

Sequence
GCSARNQRCPPNAAWVWCAVVSIHPDVFDI
Sequence evidence nucleic acid level
Average Mass 3310.78
Monoisotopic Mass 3308.54
Isoelectric Point 7.68
Extinction Coefficient [280nm] 11125.00

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Protein Precursor Tu032 precursor (8057)
Nucleic acids
Structure

External links

Tools