Tu043 (P08069) Protein Card

General Information
Name Tu043
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Tu043 precursor (7978)

Classification
Conopeptide class conotoxin
Gene superfamily O3 superfamily
Pharmacological family

Sequence
SRPKTKECERYCELEEKHCCCIRSNGPKCSRICIFKFWC
Sequence evidence nucleic acid level
Average Mass 4707.50
Monoisotopic Mass 4704.10
Isoelectric Point 11.21
Extinction Coefficient [280nm] 6990.00

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Protein Precursor Tu043 precursor (7978)
Nucleic acids
Structure

External links

Tools