T8.1 (P08095) Protein Card

General Information
Name T8.1 (named by ConoServer)
Alternative name(s) Tu077
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor T8.1 precursor (8006)

Classification
Conopeptide class conotoxin
Gene superfamily S superfamily
Cysteine framework VIII
Pharmacological family

Sequence
FGPICTCFKSQNCRGSCECMSPPGCYCSNNGIRERGCSCTC
PGT
Sequence evidence nucleic acid level
Average Mass 4649.24
Monoisotopic Mass 4645.74
Isoelectric Point 11.51
Extinction Coefficient [280nm] 1490.00

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Protein Precursor T8.1 precursor (8006)
Nucleic acids
Structure

External links

Tools