Ca1.12 (P08103) Protein Card

General Information
Name Ca1.12 (named by ConoServer)
Alternative name(s) Ca-8
Organism Conus caracteristicus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ca1.12 precursor (7673)

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Cysteine framework I
Pharmacological family

Sequence
NVWFTPDECCRDPPCREKILEYCLAGEAVAAAFGFRQLPYR
LSSE
Sequence evidence nucleic acid level
Average Mass 5148.84
Monoisotopic Mass 5145.40
Isoelectric Point 5.76
Extinction Coefficient [280nm] 8480.00

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Protein Precursor Ca1.12 precursor (7673)
Nucleic acids
Structure

External links

Tools