Ca20.1 (P08104) Protein Card

General Information
Name Ca20.1 (named by ConoServer)
Alternative name(s) Ca-15
Organism Conus caracteristicus (characteristic cone)
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ca20.1 precursor (7680)

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Cysteine framework XX
Pharmacological family

Sequence
ADYAMCFRHRPGSLWGRCCLTKMCGSACCNHSFCRCTHDKD
MGHGCAC
Sequence evidence nucleic acid level
Average Mass 5322.11
Monoisotopic Mass 5318.04
Isoelectric Point 11.63
Extinction Coefficient [280nm] 6990.00

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Protein Precursor Ca20.1 precursor (7680)
Nucleic acids
Structure

External links

Tools