CalTx 12.1.4A (P00811) Protein Card

General Information
Name CalTx 12.1.4A
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Notes This sequence has been removed from GenBank at the submitter's request because the sequence cannot be confirmed.

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XII
Pharmacological family

Sequence
DVCDSLVDGRCIHNGCFCEESKPNGNCCDTDGCTARWWCPG
TKWD
Sequence evidence Unknown
Average Mass 4990.43
Monoisotopic Mass 4986.92
Isoelectric Point 4.72
Extinction Coefficient [280nm] 16500.00

References
Gilly,W.F., Richmond,T., Elliger,C.A., Lebaric,Z.N., Schulz,J., Bingham,J.P. and Sweedler,J.V. (0) Extreme Diversity in a Novel Family of Peptide Toxins from Conus californicus

Internal links
Nucleic acids Conus californicus conotoxin CalTx 12.1.4A mRNA, partial cds
Structure

External links
Ncbi ABR92962

Tools