Ca6.4 (P08113) Protein Card

General Information
Name Ca6.4 (named by ConoServer)
Alternative name(s) Ca-26
Organism Conus caracteristicus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ca6.4 precursor (7689)

Classification
Conopeptide class conotoxin
Gene superfamily I3 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CKLSGEDCGYGYSCCEDLSCRPLIEPDTLKITALVCQIESA
Sequence evidence nucleic acid level
Average Mass 4422.01
Monoisotopic Mass 4418.95
Isoelectric Point 4.88
Extinction Coefficient [280nm] 2980.00

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Protein Precursor Ca6.4 precursor (7689)
Nucleic acids
Structure

External links

Tools