Ca14.6 (P08121) Protein Card

General Information
Name Ca14.6 (named by ConoServer)
Alternative name(s) Ca-34
Organism Conus caracteristicus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ca14.6 precursor (7696)

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Cysteine framework XIV
Pharmacological family

Sequence
VPAQPVLDIICPGMCLLGIGEPFCNCSNKRDVVSSQIT
Sequence evidence nucleic acid level
Average Mass 4014.72
Monoisotopic Mass 4011.94
Isoelectric Point 4.80
Extinction Coefficient [280nm] NA

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Protein Precursor Ca14.6 precursor (7696)
Nucleic acids
Structure

External links

Tools