Cal12.2a precursor (P00815) Protein Card

General Information
Name Cal12.2a precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVLVVLLLVLPFGDL
ITTSNTEDNKRGATPWQNSLKA
R
GVCSTPEGSCVHNGCICQNAPCCHPSGCNWANVCPGFLWD
KN
Sequence region
[1-19]signal sequence
[43-84]mature peptideCal12.2f

References
Gilly, W.F., Richmond, T.A., Duda, T.F., Elliger, C., Lebaric, Z., Schulz, J., Bingham, J.P. and Sweedler, J.V., (2011) Gilly, W.F., Richmond, T.A., Duda, T.F., Elliger, C., Lebaric, Z., Schulz, J., Bingham, J.P. and Sweedler, J.V., 2011. A diverse family of novel peptide toxins from an unusual cone snail, Conus californicus Journal of Experimental Biology 214:147-161

Internal links
Nucleic acids Cal12.2a mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot A6YR42
Ncbi A6YR42, ABR92966

Tools