Cal12.2b precursor (P00817) Protein Card

General Information
Name Cal12.2b precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVLVVLLLVLPFGDL
ITTSNTEDNKRGATPWQNSLKA
R
GVCSTPEGSCVHNGCICQNAPCCHPSGCNWVNVCPGFLWD
KN
Sequence region
[1-19]signal sequence
[43-84]mature peptideCal12.2b

References
Gilly,W.F., Richmond,T., Elliger,C.A., Lebaric,Z.N., Schulz,J., Bingham,J.P. and Sweedler,J.V. (0) Extreme Diversity in a Novel Family of Peptide Toxins from Conus californicus

Internal links
Nucleic acids Cal12.2b mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot A7LI90
Ncbi A7LI90, ABS59785

Tools