Cal12.2c (P00818) Protein Card

General Information
Name Cal12.2c
Alternative name(s) CalTx 12.2.1C
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XII
Pharmacological family

Sequence
RGVCSTPEGSCVHNGCICQNAPCCHPSGCNWANVCPGYLWD
KN
Sequence evidence Unknown
Average Mass 4574.09
Monoisotopic Mass 4570.81
Isoelectric Point 8.04
Extinction Coefficient [280nm] 12490.00

References
Gilly,W.F., Richmond,T., Elliger,C.A., Lebaric,Z.N., Schulz,J., Bingham,J.P. and Sweedler,J.V. (0) Extreme Diversity in a Novel Family of Peptide Toxins from Conus californicus

Internal links
Nucleic acids Cal12.2c mRNA, partial cds
Structure

External links
UniProtKB/Swiss-Prot A7LI91
Ncbi A7LI91, ABS59786

Tools