Ca15.4 (P08190) Protein Card

General Information
Name Ca15.4 (named by ConoServer)
Alternative name(s) Ca-70
Organism Conus caracteristicus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ca15.4 precursor (8189)

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework XV
Pharmacological family

Sequence
ECTPMHRACEEDEECCPNLECKCSNNPDCQSGYKCRP
Sequence evidence nucleic acid level
Average Mass 4215.61
Monoisotopic Mass 4212.54
Isoelectric Point 4.96
Extinction Coefficient [280nm] 1490.00

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Protein Precursor Ca15.4 precursor (8189)
Nucleic acids
Structure

External links

Tools