Ca-11 (P08205) Protein Card

General Information
Name Ca-11
Organism Conus caracteristicus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ca-11 precursor (7676)

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Pharmacological family

Sequence
NPWYTPEECCMDLVCRKIVRFGKDFAAALDFRRLSYR
Sequence evidence nucleic acid level
Average Mass 4469.20
Monoisotopic Mass 4466.17
Isoelectric Point 9.90
Extinction Coefficient [280nm] 8605.00

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Protein Precursor Ca-11 precursor (7676)
Nucleic acids
Structure

External links

Tools