Ge3.1 (P08220) Protein Card

General Information
Name Ge3.1 (named by ConoServer)
Alternative name(s) Ge-15
Organism Conus generalis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ge3.1 precursor (7774)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework III
Pharmacological family

Sequence
KEIIVPALRQNTNSDEEDCCIYPWCDGDCLCC
Sequence evidence nucleic acid level
Average Mass 3644.05
Monoisotopic Mass 3641.47
Isoelectric Point 4.38
Extinction Coefficient [280nm] 6990.00

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Protein Precursor Ge3.1 precursor (7774)
Nucleic acids
Structure

External links

Tools