Qc27.1 (P08275) Protein Card

General Information
Name Qc27.1 (named by ConoServer)
Alternative name(s) Qu-21
Organism Conus quercinus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Qc27.1 precursor (7826)

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Cysteine framework XXVII
Pharmacological family

Sequence
SSCGYLGQPCCVVPRRAYCHGDLECNDVTMCV
Sequence evidence nucleic acid level
Average Mass 3473.95
Monoisotopic Mass 3471.40
Isoelectric Point 6.85
Extinction Coefficient [280nm] 2980.00

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Protein Precursor Qc27.1 precursor (7826)
Nucleic acids
Structure

External links

Tools