Conodipine-P4 alpha chain (P08304) Protein Card

General Information
Name Conodipine-P4 alpha chain (named by ConoServer)
Alternative name(s) Cdpi-P4 alpha chain
Organism Conus purpurascens
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Conodipine-P4 precursor (7904)

Classification
Conopeptide class conodipine
Gene superfamily conodipine superfamily
Pharmacological family

Sequence
KESCTKHSNGCSTPLRLPCQEYFRPACDIHDNCYHCGTIFR
ISRKECDDAFLKDMNTLCKKLGSNFATCPARG
Sequence evidence nucleic acid level
Average Mass 8239.36
Monoisotopic Mass 8233.72
Isoelectric Point 10.78
Extinction Coefficient [280nm] 2980.00

References
M├Âller, C., Davis, W.C., Clark, E., DeCaprio, A. and Mari, F. (2019) Conodipine-P1-3, the First Phospholipases A2 Characterized from Injected Cone Snail Venom Molecular & Cellular Proteomics 18:876-891

Internal links
Protein Precursor Conodipine-P4 precursor (7904)
Nucleic acids
Structure

External links

Tools