Conodipine-P6 beta chain (P08309) Protein Card

General Information
Name Conodipine-P6 beta chain (named by ConoServer)
Alternative name(s) Cdpi-P6 beta chain
Organism Conus purpurascens
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Conodipine-P6 precursor (7906)

Classification
Conopeptide class conodipine
Gene superfamily conodipine superfamily
Pharmacological family

Sequence
QVFFLLPTTCQGWAKNYHLAVKLAGANSYSVTTDLETCQGL
EHCLPNH
Sequence evidence nucleic acid level
Average Mass 5318.02
Monoisotopic Mass 5314.56
Isoelectric Point 7.26
Extinction Coefficient [280nm] 8480.00

References
Möller, C., Davis, W.C., Clark, E., DeCaprio, A. and Mari, F. (2019) Conodipine-P1-3, the First Phospholipases A2 Characterized from Injected Cone Snail Venom Molecular & Cellular Proteomics 18:876-891

Internal links
Protein Precursor Conodipine-P6 precursor (7906)
Nucleic acids
Structure

External links

Tools