Conodipine-Vc1 beta chain (P08310) Protein Card

General Information
Name Conodipine-Vc1 beta chain (named by ConoServer)
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Conodipine-Vc1 precursor (6390)

Classification
Conopeptide class conodipine
Gene superfamily
Pharmacological family

Sequence
QPQQRYIYDNCTDWALTYYNTVQRFGWWYFYDTANATYCPQ
FEPCMPEVSSSA
Sequence evidence nucleic acid level
Average Mass 6418.02
Monoisotopic Mass 6413.75
Isoelectric Point 6.54
Extinction Coefficient [280nm] 26930.00

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Protein Precursor Conodipine-Vc1 precursor (6390)
Nucleic acids
Structure

External links

Tools