Cal12.4 (P08314) Protein Card

General Information
Name Cal12.4 (named by ConoServer)
Alternative name(s) O1_cal12b
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cal12.4 precursor (7873)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework XII
Pharmacological family

Sequence
ANTGGLCGMPPGVCYPNGCACGQDTPCCHPSGCNRYNYCGP
LLE
Sequence evidence nucleic acid level
Average Mass 4487.02
Monoisotopic Mass 4483.72
Isoelectric Point 7.00
Extinction Coefficient [280nm] 4470.00

References
Bernáldez-Sarabia, J., Figueroa-Montiel, A., Dueñas, S., Cervantes-Luévano, K., Beltrán, J.A., Ortiz, E., Jiménez, S., Possani, L.D., Paniagua-Solís, J.F., Gonzalez-Canudas, J. and Licea-Navarro, A. (2019) The Diversified O-Superfamily in Californiconus californicus Presents a Conotoxin with Antimycobacterial Activity Toxins 11:128

Internal links
Protein Precursor Cal12.4 precursor (7873)
Nucleic acids
Structure

External links

Tools