Cal6.34 (P08334) Protein Card

General Information
Name Cal6.34 (named by ConoServer)
Alternative name(s) O1_cal6.34
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cal6.34 precursor (7868)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
SSCWFCSTGFNKCCESTGDCMTYPSEYNASCPEA
Sequence evidence nucleic acid level
Average Mass 3703.99
Monoisotopic Mass 3701.29
Isoelectric Point 4.94
Extinction Coefficient [280nm] 8480.00

References
Bernáldez-Sarabia, J., Figueroa-Montiel, A., Dueñas, S., Cervantes-Luévano, K., Beltrán, J.A., Ortiz, E., Jiménez, S., Possani, L.D., Paniagua-Solís, J.F., Gonzalez-Canudas, J. and Licea-Navarro, A. (2019) The Diversified O-Superfamily in Californiconus californicus Presents a Conotoxin with Antimycobacterial Activity Toxins 11:128

Internal links
Protein Precursor Cal6.34 precursor (7868)
Nucleic acids
Structure

External links

Tools