R11.5 (P00836) Protein Card

General Information
Name R11.5
Organism Conus radiatus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Notes One of the NCBI card states that this sequence is from the precursor (the mature peptide corresponds to this sequence but the last residue) while the other card states that the whole sequence is the mature peptide.

Classification
Conopeptide class conotoxin
Gene superfamily I1 superfamily
Cysteine framework XI
Pharmacological family

Sequence
GAVPCGKDGRQCRNHADCCNCCPIGTCAPSTNWILPGCSTG
QFMTR
Sequence evidence nucleic acid level
Average Mass 4823.46
Monoisotopic Mass 4819.99
Isoelectric Point 11.53
Extinction Coefficient [280nm] 5500.00

References
Jimenez,E.C., Shetty,R.P., Lirazan,M., Rivier,J., Walker,C., Abogadie,F.C., Yoshikami,D., Cruz,L.J. and Olivera,B.M. (2003) Novel excitatory Conus peptides define a new conotoxin superfamily J. Neurochem. 85:610-621

Internal links
Nucleic acids Conus radiatus I-superfamily conotoxin R11.5 (R11.5) mRNA, partial cds
Structure

External links
UniProtKB/Swiss-Prot Q7Z098
Ncbi Q7Z098, AAP41537

Tools