Am6.5 (P08403) Protein Card

General Information
Name Am6.5 (named by ConoServer)
Alternative name(s) cam3428
Organism Conus amadis
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Am6.5 precursor (8402)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DCVEVDYFCGIPFVFNGLCCSGNCVFVCTPQ
Sequence evidence protein level
Average Mass 3373.86
Monoisotopic Mass 3371.35
Isoelectric Point 4.20
Extinction Coefficient [280nm] 1490.00

References
Vijayasarathy, M. and Balaram, P. (2019) Cone snail prolyl-4-hydroxylase α-subunit sequences derived from transcriptomic data and mass spectrometric analysis of variable proline hydroxylation in C. amadis venom Journal of proteomics 194:37-48

Internal links
Protein Precursor Am6.5 precursor (8402)
Nucleic acids
Structure

External links

Tools