Lt28.5 (P08414) Protein Card

General Information
Name Lt28.5
Alternative name(s) Lt15.6a
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt28.5 precursor (4544)

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Cysteine framework XXVIII
Pharmacological family

Sequence
LHCHEISDLTPWILCSPEPLCGGKGCCAQGVCDCSGPACTC
PPCL
Sequence evidence nucleic acid level
Average Mass 4609.32
Monoisotopic Mass 4605.86
Isoelectric Point 4.96
Extinction Coefficient [280nm] 5500.00

References
Lu, J., Zhang, K., Wang, S., Sun, T., Yu, S., Dai, Q. and Liu, Z. (2017) Cloning, expression and functional characterization of a D-superfamily conotoxin Lt28. 1 with previously undescribed cysteine pattern Peptides, 94, pp.64-70 94:64-70

Internal links
Protein Precursor Lt28.5 precursor (4544)
Nucleic acids
Structure

External links
Ncbi HM003930

Tools