Lt28.6 (P08415) Protein Card

General Information
Name Lt28.6
Alternative name(s) Lt15.5a
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt28.6 precursor (4545)
Lt28.7 precursor (4546)

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Cysteine framework XXVIII
Pharmacological family

Sequence
LHCHEISDLTPWILCSPEPLCGGKGCCAQEVCDCSGPVCTC
PPCL
Sequence evidence nucleic acid level
Average Mass 4709.44
Monoisotopic Mass 4705.91
Isoelectric Point 4.68
Extinction Coefficient [280nm] 5500.00

References
Lu, J., Zhang, K., Wang, S., Sun, T., Yu, S., Dai, Q. and Liu, Z. (2017) Cloning, expression and functional characterization of a D-superfamily conotoxin Lt28. 1 with previously undescribed cysteine pattern Peptides, 94, pp.64-70 94:64-70

Internal links
Protein Precursor Lt28.6 precursor (4545)
Lt28.7 precursor (4546)
Nucleic acids
Structure

External links
Ncbi HM003931

Tools