Conkunitzin-Lt1 precursor (P08430) Protein Card

General Information
Name Conkunitzin-Lt1 precursor (named by ConoServer)
Alternative name(s) NSF-bt05-1 precursor
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conkunitzin
Gene superfamily
Pharmacological family

Sequence
MDARRVAAVLLVLFMARSLLKGSA
KDAR
CLEPLDLGDSTCS
EVRIRWYYNTGNEICQTFQYTGCGGNNNNFYDENSCKQCCE
WEYSCSKRFA
RR
Sequence evidence nucleic acid level
Sequence region
[1-24]signal sequence
[25-28]pro region
[29-92]mature peptideConkunitzin-Lt1

References
Zhang, H., Fu, Y., Wang, L., Liang, A., Chen, S. and Xu, A. (2019) Identifying novel conopepetides from the venom ducts of Conus litteratus through integrating transcriptomics and proteomics Journal of proteomics 192:346-357

Internal links
Nucleic acids
Structure

External links

Tools