Conkunitzin-Lt1 (P08431) Protein Card

General Information
Name Conkunitzin-Lt1 (named by ConoServer)
Alternative name(s) NSF-bt05-1
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Conkunitzin-Lt1 precursor (8430)

Classification
Conopeptide class conkunitzin
Gene superfamily
Pharmacological family

Sequence
CLEPLDLGDSTCSEVRIRWYYNTGNEICQTFQYTGCGGNNN
NFYDENSCKQCCEWEYSCSKRFA
Sequence evidence nucleic acid level
Average Mass 7451.07
Monoisotopic Mass 7446.04
Isoelectric Point 5.95
Extinction Coefficient [280nm] 18450.00

References
Zhang, H., Fu, Y., Wang, L., Liang, A., Chen, S. and Xu, A. (2019) Identifying novel conopepetides from the venom ducts of Conus litteratus through integrating transcriptomics and proteomics Journal of proteomics 192:346-357

Internal links
Protein Precursor Conkunitzin-Lt1 precursor (8430)
Nucleic acids
Structure

External links

Tools