EVIA precursor (P08467) Protein Card

General Information
Name EVIA precursor (named by ConoServer)
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism region Western Atlantic and Caribbean,Eastern Atlantic and Mediterranean
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
MKLTCVMIVAVLFLTAWTFVTA
DDSKNGLENHFWKARDEMK
NREASKLDKK
DDCIKPYGFCSLPILKNGLCCSGACVGVCAD
L
R
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence
[23-51]pro region
[52-83]mature peptideEVIA

References
Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links
Nucleic acids EVIA precursor
Structure

External links

Tools