E21.1 (P08474) Protein Card

General Information
Name E21.1 (named by ConoServer)
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism region Eastern Atlantic and Mediterranean,Western Atlantic and Caribbean
Organism diet piscivorous
Protein Type Wild type
Protein precursor E21.1 precursor (8473)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XXI
Pharmacological family

Sequence
DDCCIGNTYGCLKRRPGQEHEQVMPCKHEATIRCPGSDIDG
CCPGYATCMSIFAKDNLIPAHYHCEKRPCYT
Sequence evidence nucleic acid level
Average Mass 8043.11
Monoisotopic Mass 8037.46
Isoelectric Point 7.48
Extinction Coefficient [280nm] 5960.00

References
Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links
Protein Precursor E21.1 precursor (8473)
Nucleic acids
Structure

External links

Tools