Con-ikot-ikot-E1 (P08474) Protein Card

General Information
Name Con-ikot-ikot-E1 (named by ConoServer)
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism region Western Atlantic and Caribbean,Eastern Atlantic and Mediterranean
Organism diet piscivorous
Protein Type Wild type
Protein precursor Con-ikot-ikot-E1 precursor (8473)

Classification
Conopeptide class con-ikot-ikot
Gene superfamily
Pharmacological family

Sequence
DDCCIGNTYGCLKRRPGQEHEQVMPCKHEATIRCPGSDIDG
CCPGYATCMSIFAKDNLIPAHYHCEKRPCYT
Sequence evidence nucleic acid level
Average Mass 8043.11
Monoisotopic Mass 8037.46
Isoelectric Point 7.48
Extinction Coefficient [280nm] 5960.00

References
Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links
Protein Precursor Con-ikot-ikot-E1 precursor (8473)
Nucleic acids
Structure

External links

Tools