Conkunitzin-E3 (P08477) Protein Card

General Information
Name Conkunitzin-E3 (named by ConoServer)
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism region Eastern Atlantic and Mediterranean,Western Atlantic and Caribbean
Organism diet piscivorous
Protein Type Wild type
Protein precursor Conkunitzin-E3 precursor (8476)

Classification
Conopeptide class conkunitzin
Gene superfamily
Pharmacological family

Sequence
DTVPGLSALTVDDDTVPDVCRQPLEVGPCKAAYPRYYYNHA
SDTCQLFYYGGCNGNENRFEDFSGCLFTCIYPWMAALGY
Sequence evidence nucleic acid level
Average Mass 8944.91
Monoisotopic Mass 8938.93
Isoelectric Point 6.18
Extinction Coefficient [280nm] 17420.00

References
Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links
Protein Precursor Conkunitzin-E3 precursor (8476)
Nucleic acids
Structure

External links

Tools