Conkunitzin-E4 (P08479) Protein Card

General Information
Name Conkunitzin-E4 (named by ConoServer)
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism region Eastern Atlantic and Mediterranean,Western Atlantic and Caribbean
Organism diet piscivorous
Protein Type Wild type
Protein precursor Conkunitzin-E4 precursor (8478)

Classification
Conopeptide class conkunitzin
Gene superfamily
Pharmacological family

Sequence
CHLPPETGMCRAYIPMHFYNATLGRCQGFIYGGCNGNDN
Sequence evidence nucleic acid level
Average Mass 4318.87
Monoisotopic Mass 4315.84
Isoelectric Point 8.97
Extinction Coefficient [280nm] 4470.00

References
Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links
Protein Precursor Conkunitzin-E4 precursor (8478)
Nucleic acids
Structure

External links

Tools