E20.1 precursor (P08482) Protein Card

General Information
Name E20.1 precursor (named by ConoServer)
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism region Western Atlantic and Caribbean,Eastern Atlantic and Mediterranean
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Cysteine framework XX
Pharmacological family

Sequence
MPRLEMMLLVLLILPLPYFNAAGG
QAVQGDGQGDRMDRYLQ
RGDR
AVIATCHPNYPGSPWGRCCTTKMCGSVCCNYAHCSCV
YHSDMGDGCSC
Sequence evidence nucleic acid level
Sequence region
[1-24]signal sequence
[25-45]pro region
[46-93]mature peptideE20.1

References
Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links
Nucleic acids E20.1 precursor
Structure

External links

Tools