E20.1 (P08483) Protein Card

General Information
Name E20.1 (named by ConoServer)
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism region Eastern Atlantic and Mediterranean,Western Atlantic and Caribbean
Organism diet piscivorous
Protein Type Wild type
Protein precursor E20.1 precursor (8482)

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Cysteine framework XX
Pharmacological family

Sequence
AVIATCHPNYPGSPWGRCCTTKMCGSVCCNYAHCSCVYHSD
MGDGCSC
Sequence evidence nucleic acid level
Average Mass 5070.71
Monoisotopic Mass 5066.85
Isoelectric Point 8.64
Extinction Coefficient [280nm] 9970.00

References
Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links
Protein Precursor E20.1 precursor (8482)
Nucleic acids
Structure

External links

Tools