VilXIVB precursor (P08493) Protein Card

General Information
Name VilXIVB precursor (named by ConoServer)
Alternative name(s) Vil14.3 precursor
Organism Conus villepinii
Organism region Western Atlantic and Caribbean
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily R superfamily
Cysteine framework XIV
Pharmacological family

Sequence
MGFRVLVLVVMATTSALPFTFS
EEPGRSPFRPALRSEEAQA
LRHGLTLLLARRADGQPPDMRQPEMRRPEMRRPEVRQPEFA
ELSVGQRR
WDVDQCMYYCLTGVVGYSYTECETMCT
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence
[23-90]pro region
[91-117]mature peptideVilXIVB

References
Möller, C., Dovell, S., Melaun, C. and Marí, F. (2018) Definition of the R-superfamily of conotoxins: Structural convergence of helix-loop-helix peptidic scaffolds Peptides 107:75-82

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot A0A3G1VU81
Ncbi A0A3G1VU81

Tools