Conkunitzin-C9.1 (P08529) Protein Card

General Information
Name Conkunitzin-C9.1 (named by ConoServer)
Alternative name(s) Ca095
Organism Conus catus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class conkunitzin
Gene superfamily
Cysteine framework IX
Pharmacological family

Sequence
SAYAAWQCFLPKEDGLCKGKFSRYYFDSALRMCRRFIYGGC
GGNGNRFITKDACLNTCLY
Sequence evidence protein level
Average Mass 6845.86
Monoisotopic Mass 6841.16
Isoelectric Point 11.74
Extinction Coefficient [280nm] 12950.00

References
Himaya, S.W.A., Jin, A.H., Dutertre, S., Giacomotto, J., Mohialdeen, H., Vetter, I., Alewood, P.F. and Lewis, R.J. (2015) Comparative venomics reveals the complex prey capture strategy of the piscivorous cone snail Conus catus. Journal of proteome research 14:4372-4381

Internal links
Nucleic acids
Structure

External links

Tools