Conoporin-C102 (P08531) Protein Card

General Information
Name Conoporin-C102 (named by ConoServer)
Alternative name(s) Ca102
Organism Conus catus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class conoporin
Gene superfamily
Pharmacological family

Sequence
KSSIPLSKVAKVASKVVTPGPSLNGVALKDLADTNYKITCV
FQVENWTRYRLIVPRVHMAFGVITTNPTAIEPGKREAFAVR
KTSDTASGVAGSVSWELEEARRRVVVMWSVPYEL
Sequence evidence protein level
Average Mass 12746.81
Monoisotopic Mass 12738.80
Isoelectric Point 11.04
Extinction Coefficient [280nm] 21095.00

References
Himaya, S.W.A., Jin, A.H., Dutertre, S., Giacomotto, J., Mohialdeen, H., Vetter, I., Alewood, P.F. and Lewis, R.J. (2015) Comparative venomics reveals the complex prey capture strategy of the piscivorous cone snail Conus catus. Journal of proteome research 14:4372-4381

Internal links
Nucleic acids
Structure

External links

Tools