reg3b precursor (P08532) Protein Card

General Information
Name reg3b precursor
Alternative name(s) Rg3.13 precursor
Organism Conus regius
Organism region Eastern Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework III
Pharmacological family

Sequence
LTAIPLDGDQPADQPAERMEDGESTPNHPWFDPVKR
CCTAL
CSRYHCLPCC
Sequence evidence nucleic acid level
Sequence region
[37-51]mature peptidereg3b

References
Franco,A., Dovell,S., Möller,C., Grandal,M., Clark,E. and Marí,F. (2018) Structural plasticity of mini-M conotoxins - expression of all mini-M subtypes by Conus regius. FEBS J. 285:887-902

Internal links
Nucleic acids reg3b precursor
Structure

External links
Ncbi AUJ88071

Tools